| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
| Family a.25.2.0: automated matches [191442] (1 protein) not a true family |
| Protein automated matches [190652] (6 species) not a true protein |
| Species Lactobacillus reuteri [TaxId:1598] [188444] (9 PDB entries) |
| Domain d3gaia_: 3gai A: [176477] automated match to d1rtyb_ complexed with atp, b12, cl, gol, k, mg |
PDB Entry: 3gai (more details), 1.48 Å
SCOPe Domain Sequences for d3gaia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gaia_ a.25.2.0 (A:) automated matches {Lactobacillus reuteri [TaxId: 1598]}
kiytkngdkgqtriigkqilykndprvaaygevdelnswvgytkslinshtqvlsnelee
iqqllfdcghdlatpadderhsfkfkqeqptvwleekidnytqvvpavkkailpggtqla
salhvartitrraerqivqlmreeqinqdvlifinrlsdyffaaaryanyleqqpdmlyr
n
Timeline for d3gaia_: