| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
| Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
| Species Plasmodium yoelii [TaxId:73239] [189143] (2 PDB entries) |
| Domain d3gadf1: 3gad F:2-116 [176471] Other proteins in same PDB: d3gadc2, d3gade2, d3gadf2 automated match to d1mfia_ complexed with acy, so4 |
PDB Entry: 3gad (more details), 1.8 Å
SCOPe Domain Sequences for d3gadf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gadf1 d.80.1.3 (F:2-116) Microphage migration inhibition factor (MIF) {Plasmodium yoelii [TaxId: 73239]}
pccelitnisipddkaqnalseiedaisnvlgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnssladkitkilsnhlgvkprrvyiefrdcsaqnfafsgslfg
Timeline for d3gadf1: