SCOPe 2.01: Domain d3gacb_: 3gac B:

Lineage for d3gacb_ (3gac B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Plasmodium yoelii [TaxId:73239] [189143] (2 PDB entries)

8. Domain d3gacb_: 3gac B: [176461]
   automated match to d1mfia_
   complexed with acy, eno, so4

Details for d3gacb_

PDB Entry: 3gac, 2.1 Å

PDB Description: Structure of mif with HPP

PDB Compounds: (B:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d3gacb_:

Sequence; same for both SEQRES and ATOM records:

>d3gacb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Plasmodium yoelii [TaxId: 73239]}
pccelitnisipddkaqnalseiedaisnvlgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnssladkitkilsnhlgvkprrvyiefrdcsaqnfafsgslfgl

Timeline for d3gacb_:

• d3gacb_ is new in SCOPe 2.01-stable
  
• d3gacb_ appears in SCOPe 2.02
  
• d3gacb_ appears in the current release, SCOPe 2.08, called d3gacb1