SCOPe 2.08: Domain d3gacb1: 3gac B:2-116

Lineage for d3gacb1 (3gac B:2-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)
   automatically mapped to Pfam PF01187

6. Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Plasmodium yoelii [TaxId:73239] [189143] (2 PDB entries)

8. Domain d3gacb1: 3gac B:2-116 [176461]
   Other proteins in same PDB: d3gacb2, d3gacc2, d3gacf2
   automated match to d1mfia_
   complexed with acy, eno, so4

Details for d3gacb1

PDB Entry: 3gac, 2.1 Å

PDB Description: Structure of mif with HPP

PDB Compounds: (B:) Macrophage migration inhibitory factor-like protein

SCOPe Domain Sequences for d3gacb1:

Sequence; same for both SEQRES and ATOM records:

>d3gacb1 d.80.1.3 (B:2-116) Microphage migration inhibition factor (MIF) {Plasmodium yoelii [TaxId: 73239]}
pccelitnisipddkaqnalseiedaisnvlgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnssladkitkilsnhlgvkprrvyiefrdcsaqnfafsgslfg

Timeline for d3gacb1:

• d3gacb1 first appeared in SCOPe 2.01, called d3gacb_
  
• d3gacb1 appears in SCOPe 2.07