| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
| Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
| Species Plasmodium yoelii [TaxId:73239] [189143] (2 PDB entries) |
| Domain d3gaca_: 3gac A: [176460] Other proteins in same PDB: d3gacb2, d3gacc2, d3gacf2 automated match to d1mfia_ complexed with acy, eno, so4 |
PDB Entry: 3gac (more details), 2.1 Å
SCOPe Domain Sequences for d3gaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gaca_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Plasmodium yoelii [TaxId: 73239]}
pccelitnisipddkaqnalseiedaisnvlgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnssladkitkilsnhlgvkprrvyiefrdcsaqnfafsgslfg
Timeline for d3gaca_: