![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Galactose/glucose-binding protein [53830] (2 species) |
![]() | Species Salmonella typhimurium, strain lt2 [TaxId:90371] [53832] (4 PDB entries) |
![]() | Domain d3ga5a_: 3ga5 A: [176458] automated match to d1gcaa_ complexed with ca, na, rgg, scn |
PDB Entry: 3ga5 (more details), 1.87 Å
SCOPe Domain Sequences for d3ga5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ga5a_ c.93.1.1 (A:) Galactose/glucose-binding protein {Salmonella typhimurium, strain lt2 [TaxId: 90371]} trigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgvka lainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqgdl iakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldtam wdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpeal alvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdkdn lseft
Timeline for d3ga5a_: