SCOPe 2.08: Domain d3g9xa1: 3g9x A:4-293

Lineage for d3g9xa1 (3g9x A:4-293)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)

8. Domain d3g9xa1: 3g9x A:4-293 [176457]
   Other proteins in same PDB: d3g9xa2
   automated match to d1bn6a_
   complexed with act, cl, ipa; mutant

Details for d3g9xa1

PDB Entry: 3g9x, 0.95 Å

PDB Description: structure of haloalkane dehalogenase dhaa14 mutant i135f from rhodococcus rhodochrous

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d3g9xa1:

Sequence; same for both SEQRES and ATOM records:

>d3g9xa1 c.69.1.8 (A:4-293) automated matches {Rhodococcus sp. [TaxId: 1831]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpfptwdewpefaretfqafrtadvgreliidqnafiegalpkcvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

Timeline for d3g9xa1:

• d3g9xa1 first appeared in SCOPe 2.01, called d3g9xa_
  
• d3g9xa1 appears in SCOPe 2.07