SCOPe 2.08: Domain d3g9vd_: 3g9v D:

Lineage for d3g9vd_ (3g9v D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)

8. Domain d3g9vd_: 3g9v D: [176456]
   automated match to d1m4ra_

Details for d3g9vd_

PDB Entry: 3g9v, 2.76 Å

PDB Description: Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22

PDB Compounds: (D:) Interleukin-22

SCOPe Domain Sequences for d3g9vd_:

Sequence, based on SEQRES records:

>d3g9vd_ a.26.1.3 (D:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
rldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnftl
eevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklgesge
ikaigeldllfmslrnaci

Sequence, based on observed residues (ATOM records):

>d3g9vd_ a.26.1.3 (D:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
rldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnftl
eevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeldl
lfmslrnaci

Timeline for d3g9vd_:

• d3g9vd_ first appeared in SCOPe 2.01
  
• d3g9vd_ appears in SCOPe 2.07