| Class g: Small proteins [56992] (94 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
| Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries) |
| Domain d3g9ob1: 3g9o B:440-511 [176452] Other proteins in same PDB: d3g9oa2, d3g9ob2 automated match to d1glua_ protein/DNA complex; complexed with zn |
PDB Entry: 3g9o (more details), 1.65 Å
SCOPe Domain Sequences for d3g9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g9ob1 g.39.1.2 (B:440-511) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnleark
Timeline for d3g9ob1: