Lineage for d6gsta1 (6gst A:85-217)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281638Protein Class mu GST [81348] (3 species)
  7. 281672Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 281687Domain d6gsta1: 6gst A:85-217 [17645]
    Other proteins in same PDB: d6gsta2, d6gstb2

Details for d6gsta1

PDB Entry: 6gst (more details), 2.2 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gsta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d6gsta1:

Click to download the PDB-style file with coordinates for d6gsta1.
(The format of our PDB-style files is described here.)

Timeline for d6gsta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsta2