Lineage for d3g9mb1 (3g9m B:440-515)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640334Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)
  7. 2640335Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)
  8. 2640337Domain d3g9mb1: 3g9m B:440-515 [176449]
    Other proteins in same PDB: d3g9ma2, d3g9mb2
    automated match to d1glua_
    protein/DNA complex; complexed with edo, zn

Details for d3g9mb1

PDB Entry: 3g9m (more details), 1.61 Å

PDB Description: GR DNA-binding domain:Sgk 16bp complex-44
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3g9mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9mb1 g.39.1.2 (B:440-515) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnlearktkkk

SCOPe Domain Coordinates for d3g9mb1:

Click to download the PDB-style file with coordinates for d3g9mb1.
(The format of our PDB-style files is described here.)

Timeline for d3g9mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g9mb2