Lineage for d3g9da_ (3g9d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349614Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2349615Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2349620Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2349621Protein automated matches [191071] (2 species)
    not a true protein
  7. 2349622Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries)
  8. 2349625Domain d3g9da_: 3g9d A: [176440]
    automated match to d1t5ja_
    complexed with mg

Details for d3g9da_

PDB Entry: 3g9d (more details), 2.5 Å

PDB Description: Crystal structure glycohydrolase
PDB Compounds: (A:) Dinitrogenase reductase activacting glicohydrolase

SCOPe Domain Sequences for d3g9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9da_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
sirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddtem
sihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepeseyha
gngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggdvr
dvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqggda
dttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapal

SCOPe Domain Coordinates for d3g9da_:

Click to download the PDB-style file with coordinates for d3g9da_.
(The format of our PDB-style files is described here.)

Timeline for d3g9da_: