Class a: All alpha proteins [46456] (289 folds) |
Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily) multihelical; bundle |
Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) |
Family a.209.1.0: automated matches [191592] (1 protein) not a true family |
Protein automated matches [191071] (2 species) not a true protein |
Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries) |
Domain d3g9da_: 3g9d A: [176440] automated match to d1t5ja_ complexed with mg |
PDB Entry: 3g9d (more details), 2.5 Å
SCOPe Domain Sequences for d3g9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g9da_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]} sirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddtem sihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepeseyha gngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggdvr dvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqggda dttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapal
Timeline for d3g9da_: