Lineage for d3g9da_ (3g9d A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736587Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2736588Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2736593Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2736594Protein automated matches [191071] (2 species)
    not a true protein
  7. 2736595Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries)
  8. 2736598Domain d3g9da_: 3g9d A: [176440]
    automated match to d1t5ja_
    complexed with mg

Details for d3g9da_

PDB Entry: 3g9d (more details), 2.5 Å

PDB Description: Crystal structure glycohydrolase
PDB Compounds: (A:) Dinitrogenase reductase activacting glicohydrolase

SCOPe Domain Sequences for d3g9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9da_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
sirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddtem
sihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepeseyha
gngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggdvr
dvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqggda
dttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapal

SCOPe Domain Coordinates for d3g9da_:

Click to download the PDB-style file with coordinates for d3g9da_.
(The format of our PDB-style files is described here.)

Timeline for d3g9da_: