Lineage for d5gstb1 (5gst B:85-217)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769870Protein Class mu GST [81348] (3 species)
  7. 769932Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 769950Domain d5gstb1: 5gst B:85-217 [17644]
    Other proteins in same PDB: d5gsta2, d5gstb2
    complexed with gdb, so4

Details for d5gstb1

PDB Entry: 5gst (more details), 2 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d5gstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gstb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d5gstb1:

Click to download the PDB-style file with coordinates for d5gstb1.
(The format of our PDB-style files is described here.)

Timeline for d5gstb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gstb2