Lineage for d3g9cc_ (3g9c C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952186Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2952191Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 2952240Domain d3g9cc_: 3g9c C: [176438]
    automated match to d1auda_
    protein/RNA complex; complexed with glp, mg

Details for d3g9cc_

PDB Entry: 3g9c (more details), 2.9 Å

PDB Description: crystal structure of the product bacillus anthracis glms ribozyme
PDB Compounds: (C:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3g9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9cc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

SCOPe Domain Coordinates for d3g9cc_:

Click to download the PDB-style file with coordinates for d3g9cc_.
(The format of our PDB-style files is described here.)

Timeline for d3g9cc_: