SCOPe 2.07: Domain d3g9cb_: 3g9c B:

Lineage for d3g9cb_ (3g9c B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d3g9cb_: 3g9c B: [176437]
   automated match to d1auda_
   protein/RNA complex; complexed with glp, mg

Details for d3g9cb_

PDB Entry: 3g9c, 2.9 Å

PDB Description: crystal structure of the product bacillus anthracis glms ribozyme

PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3g9cb_:

Sequence; same for both SEQRES and ATOM records:

>d3g9cb_ d.58.7.1 (B:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

Timeline for d3g9cb_:

• d3g9cb_ first appeared in SCOPe 2.01
  
• d3g9cb_ appears in SCOPe 2.06
  
• d3g9cb_ appears in the current release, SCOPe 2.08