SCOPe 2.02: Domain d3g9ab_: 3g9a B:

Lineage for d3g9ab_ (3g9a B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (15 species)
   not a true protein

7. Species Lama pacos [TaxId:30538] [189142] (2 PDB entries)

8. Domain d3g9ab_: 3g9a B: [176435]
   Other proteins in same PDB: d3g9aa_
   automated match to d1kxtb_

Details for d3g9ab_

PDB Entry: 3g9a, 1.61 Å

PDB Description: green fluorescent protein bound to minimizer nanobody

PDB Compounds: (B:) Minimizer

SCOPe Domain Sequences for d3g9ab_:

Sequence; same for both SEQRES and ATOM records:

>d3g9ab_ b.1.1.1 (B:) automated matches {Lama pacos [TaxId: 30538]}
vqlqesgggsvqaggslrlscaasgdtfssysmawfrqapgkecelvsnilrdgtttyag
svkgrftisrddakntvylqmvnlksedtaryycaadsgtqlgyvgavglscldyvmdyw
gkgtqvtvs

Timeline for d3g9ab_:

• d3g9ab_ first appeared in SCOPe 2.01
  
• d3g9ab_ appears in SCOPe 2.03
  
• d3g9ab_ appears in the current release, SCOPe 2.08, called d3g9ab1