Lineage for d3g9ab1 (3g9a B:2-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347169Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2347174Domain d3g9ab1: 3g9a B:2-111 [176435]
    Other proteins in same PDB: d3g9aa_, d3g9ab2
    automated match to d1kxtb_

Details for d3g9ab1

PDB Entry: 3g9a (more details), 1.61 Å

PDB Description: Green fluorescent protein bound to minimizer nanobody
PDB Compounds: (B:) Minimizer

SCOPe Domain Sequences for d3g9ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9ab1 b.1.1.1 (B:2-111) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqesgggsvqaggslrlscaasgdtfssysmawfrqapgkecelvsnilrdgtttyag
svkgrftisrddakntvylqmvnlksedtaryycaadsgtqlgyvgavglscldyvmdyw
gkgtqvtv

SCOPe Domain Coordinates for d3g9ab1:

Click to download the PDB-style file with coordinates for d3g9ab1.
(The format of our PDB-style files is described here.)

Timeline for d3g9ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g9ab2
View in 3D
Domains from other chains:
(mouse over for more information)
d3g9aa_