Class a: All alpha proteins [46456] (258 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries) |
Domain d5gsta1: 5gst A:85-217 [17643] Other proteins in same PDB: d5gsta2, d5gstb2 |
PDB Entry: 5gst (more details), 2 Å
SCOP Domain Sequences for d5gsta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls tpifsklaqwsnk
Timeline for d5gsta1: