Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d3g8ob_: 3g8o B: [176424] automated match to d1a28a_ complexed with 30x, so4 |
PDB Entry: 3g8o (more details), 1.9 Å
SCOPe Domain Sequences for d3g8ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8ob_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila gmvkpllfhk
Timeline for d3g8ob_: