Lineage for d3g8ka_ (3g8k A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048472Protein automated matches [190329] (5 species)
    not a true protein
  7. 1048487Species Mouse (Mus musculus) [TaxId:10090] [187300] (2 PDB entries)
  8. 1048488Domain d3g8ka_: 3g8k A: [176420]
    automated match to d1qo3c_

Details for d3g8ka_

PDB Entry: 3g8k (more details), 2 Å

PDB Description: crystal structure of murine natural killer cell receptor, ly49l4
PDB Compounds: (A:) Lectin-related NK cell receptor LY49L1

SCOPe Domain Sequences for d3g8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8ka_ d.169.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grgfekywfcygikcyyfvmdrktwsgckqtcqisslsllkidnedelkflkllvpsdsy
wiglsydnkkkdwawinngpsklalntmkynirdggcmllsktrldndncdksficicgk
rldkfph

SCOPe Domain Coordinates for d3g8ka_:

Click to download the PDB-style file with coordinates for d3g8ka_.
(The format of our PDB-style files is described here.)

Timeline for d3g8ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g8kb_