| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (5 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187300] (2 PDB entries) |
| Domain d3g8ka_: 3g8k A: [176420] automated match to d1qo3c_ |
PDB Entry: 3g8k (more details), 2 Å
SCOPe Domain Sequences for d3g8ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8ka_ d.169.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grgfekywfcygikcyyfvmdrktwsgckqtcqisslsllkidnedelkflkllvpsdsy
wiglsydnkkkdwawinngpsklalntmkynirdggcmllsktrldndncdksficicgk
rldkfph
Timeline for d3g8ka_: