SCOPe 2.08: Domain d3g8ka_: 3g8k A:

Lineage for d3g8ka_ (3g8k A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187300] (3 PDB entries)

8. Domain d3g8ka_: 3g8k A: [176420]
   automated match to d1qo3c_

Details for d3g8ka_

PDB Entry: 3g8k, 2 Å

PDB Description: crystal structure of murine natural killer cell receptor, ly49l4

PDB Compounds: (A:) Lectin-related NK cell receptor LY49L1

SCOPe Domain Sequences for d3g8ka_:

Sequence; same for both SEQRES and ATOM records:

>d3g8ka_ d.169.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grgfekywfcygikcyyfvmdrktwsgckqtcqisslsllkidnedelkflkllvpsdsy
wiglsydnkkkdwawinngpsklalntmkynirdggcmllsktrldndncdksficicgk
rldkfph

Timeline for d3g8ka_:

• d3g8ka_ first appeared in SCOPe 2.01
  
• d3g8ka_ appears in SCOPe 2.07