Lineage for d3g8ia_ (3g8i A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008939Domain d3g8ia_: 3g8i A: [176419]
    automated match to d1i7ga_
    protein/DNA complex; complexed with ro7

Details for d3g8ia_

PDB Entry: 3g8i (more details), 2.2 Å

PDB Description: Aleglitazar, a new, potent, and balanced PPAR alpha/gamma agonist for the treatment of type II diabetes
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d3g8ia_:

Sequence, based on SEQRES records: (download)

>d3g8ia_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklvan
giqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifaml
ssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaa
iiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvteha
qlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d3g8ia_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilsppfvihdmetlcmaektlvaklkeaevrifh
ccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlssvmnkdgmlvay
gngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaiiccgdrpgllnv
ghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaqlvqiikktesda
alhpllqeiyrdmy

SCOPe Domain Coordinates for d3g8ia_:

Click to download the PDB-style file with coordinates for d3g8ia_.
(The format of our PDB-style files is described here.)

Timeline for d3g8ia_: