Lineage for d3g8ga_ (3g8g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733517Species Vipera ammodytes [TaxId:8705] [188519] (3 PDB entries)
  8. 2733519Domain d3g8ga_: 3g8g A: [176417]
    automated match to d1cl5a_
    complexed with so4

Details for d3g8ga_

PDB Entry: 3g8g (more details), 1.7 Å

PDB Description: Crystal structure of phospholipase A2 ammodytoxin A from vipera ammodytes ammodytes
PDB Compounds: (A:) Phospholipase A2, ammodytoxin A

SCOPe Domain Sequences for d3g8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8ga_ a.133.1.2 (A:) automated matches {Vipera ammodytes [TaxId: 8705]}
sllefgmmilgetgknpltsysfygcycgvggkgtpkdatdrccfvhdccygnlpdcspk
tdrykyhrengaivcgkgtscenricecdraaaicfrknlktynyiyrnypdflckkese
kc

SCOPe Domain Coordinates for d3g8ga_:

Click to download the PDB-style file with coordinates for d3g8ga_.
(The format of our PDB-style files is described here.)

Timeline for d3g8ga_: