Lineage for d3g8fa_ (3g8f A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925358Protein Snake phospholipase A2 [48624] (35 species)
  7. 925543Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (28 PDB entries)
    Uniprot P59071
  8. 925549Domain d3g8fa_: 3g8f A: [176416]
    complexed with so4

Details for d3g8fa_

PDB Entry: 3g8f (more details), 1.25 Å

PDB Description: Crystal structure of the complex formed between a group II phospholipase A2 and designed peptide inhibitor carbobenzoxy-dehydro-val-ala-arg-ser at 1.2 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d3g8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8fa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3g8fa_:

Click to download the PDB-style file with coordinates for d3g8fa_.
(The format of our PDB-style files is described here.)

Timeline for d3g8fa_: