Lineage for d3g7zb_ (3g7z B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947078Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 947079Family b.34.6.1: CcdB [50119] (1 protein)
  6. 947080Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 947081Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)
  8. 947087Domain d3g7zb_: 3g7z B: [176413]
    automated match to d1vuba_

Details for d3g7zb_

PDB Entry: 3g7z (more details), 2.35 Å

PDB Description: CcdB dimer in complex with two C-terminal CcdA domains
PDB Compounds: (B:) Cytotoxic protein ccdB

SCOPe Domain Sequences for d3g7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7zb_ b.34.6.1 (B:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOPe Domain Coordinates for d3g7zb_:

Click to download the PDB-style file with coordinates for d3g7zb_.
(The format of our PDB-style files is described here.)

Timeline for d3g7zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g7za_