SCOPe 2.05: Domain d3g7fm_: 3g7f M:

Lineage for d3g7fm_ (3g7f M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (7 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries)

8. Domain d3g7fm_: 3g7f M: [176409]
   Other proteins in same PDB: d3g7fc_, d3g7fh1, d3g7fh2
   automated match to d1dxrm_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant

Details for d3g7fm_

PDB Entry: 3g7f, 2.5 Å

PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center

PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d3g7fm_:

Sequence; same for both SEQRES and ATOM records:

>d3g7fm_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwlgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d3g7fm_:

• d3g7fm_ first appeared in SCOPe 2.01
  
• d3g7fm_ appears in SCOPe 2.04
  
• d3g7fm_ appears in SCOPe 2.06
  
• d3g7fm_ appears in the current release, SCOPe 2.08