| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (7 species) not a true protein |
| Species Blastochloris viridis [TaxId:1079] [187141] (7 PDB entries) |
| Domain d3g7fl_: 3g7f L: [176408] Other proteins in same PDB: d3g7fc_, d3g7fh1, d3g7fh2 automated match to d1prcl_ complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant |
PDB Entry: 3g7f (more details), 2.5 Å
SCOPe Domain Sequences for d3g7fl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7fl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d3g7fl_:
View in 3DDomains from other chains: (mouse over for more information) d3g7fc_, d3g7fh1, d3g7fh2, d3g7fm_ |