SCOPe 2.07: Domain d3g7fc_: 3g7f C:

Lineage for d3g7fc_ (3g7f C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)

8. Domain d3g7fc_: 3g7f C: [176407]
   Other proteins in same PDB: d3g7fh1, d3g7fh2, d3g7fl_, d3g7fm_
   automated match to d1prcc_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant

Details for d3g7fc_

PDB Entry: 3g7f, 2.5 Å

PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center

PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d3g7fc_:

Sequence; same for both SEQRES and ATOM records:

>d3g7fc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d3g7fc_:

• d3g7fc_ first appeared in SCOPe 2.01
  
• d3g7fc_ appears in SCOPe 2.06
  
• d3g7fc_ appears in the current release, SCOPe 2.08