Lineage for d3g7ea_ (3g7e A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213403Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2213461Protein automated matches [191126] (2 species)
    not a true protein
  7. 2213471Species Escherichia coli [TaxId:562] [189210] (1 PDB entry)
  8. 2213472Domain d3g7ea_: 3g7e A: [176406]
    automated match to d1kzna_
    complexed with b46

Details for d3g7ea_

PDB Entry: 3g7e (more details), 2.2 Å

PDB Description: crystal structure of e. coli gyrase b co-complexed with prop-2-yn-1-yl {[5-(4-piperidin-1-yl-2-pyridin-3-yl-1,3-thiazol-5-yl)-1h-pyrazol-3-yl]methyl}carbamate inhibitor
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3g7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7ea_ d.122.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfh

SCOPe Domain Coordinates for d3g7ea_:

Click to download the PDB-style file with coordinates for d3g7ea_.
(The format of our PDB-style files is described here.)

Timeline for d3g7ea_: