Lineage for d3g70a1 (3g70 A:4-340)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2392953Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2392961Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2392974Domain d3g70a1: 3g70 A:4-340 [176402]
    Other proteins in same PDB: d3g70a2, d3g70b2
    automated match to d1bila_
    complexed with a5t, dms, nag, ndg

Details for d3g70a1

PDB Entry: 3g70 (more details), 2 Å

PDB Description: Design and Preparation of Potent, Non-Peptidic, Bioavailable Renin Inhibitors
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d3g70a1:

Sequence, based on SEQRES records: (download)

>d3g70a1 b.50.1.2 (A:4-340) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d3g70a1 b.50.1.2 (A:4-340) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsslggqivlggsdpqhye
gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
ptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d3g70a1:

Click to download the PDB-style file with coordinates for d3g70a1.
(The format of our PDB-style files is described here.)

Timeline for d3g70a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g70a2