SCOPe 2.01: Domain d4gstb1: 4gst B:85-217

Lineage for d4gstb1 (4gst B:85-217)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)

8. Domain d4gstb1: 4gst B:85-217 [17640]
   Other proteins in same PDB: d4gsta2, d4gstb2
   complexed with gtd, so4

Details for d4gstb1

PDB Entry: 4gst, 1.9 Å

PDB Description: reaction coordinate motion in an snar reaction catalyzed by glutathione transferase

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4gstb1:

Sequence; same for both SEQRES and ATOM records:

>d4gstb1 a.45.1.1 (B:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

Timeline for d4gstb1:

• d4gstb1 first appeared (with stable ids) in SCOP 1.55
  
• d4gstb1 appears in SCOP 1.75
  
• d4gstb1 appears in SCOPe 2.02
  
• d4gstb1 appears in the current release, SCOPe 2.08