Lineage for d3g6wc_ (3g6w C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128512Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2128516Species Sulfolobus solfataricus [TaxId:2287] [142555] (5 PDB entries)
    Uniprot Q980Q4 2-216
  8. 2128539Domain d3g6wc_: 3g6w C: [176398]
    automated match to d1xtta1
    complexed with gtp, hsx, mg, pop, prp

Details for d3g6wc_

PDB Entry: 3g6w (more details), 2.9 Å

PDB Description: asymetric gtp bound structure of uprtase from sulfolobus solfataricus containing prpp-mg2+ in half of the active sites and r5p and ppi in the other half
PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d3g6wc_:

Sequence, based on SEQRES records: (download)

>d3g6wc_ c.61.1.1 (C:) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvevdgkevpkdmdvyi
yykkipdirakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkils
kypfiylftvaidpelnnkgyilpglgdagdrafg

Sequence, based on observed residues (ATOM records): (download)

>d3g6wc_ c.61.1.1 (C:) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]}
plyvidkpitlhiltqlrdkytdqinfrknlvrlgrilgyeisntldyeivevetplgvk
tkgvditdlnniviinilraavplvegllkafpkarqgvigasrvkdmdvyiyykkipdi
rakvdnviiadpmiatastmlkvleevvkanpkriyivsiisseygvnkilskypfiylf
tvaidpelnnkgyilpglgdagdrafg

SCOPe Domain Coordinates for d3g6wc_:

Click to download the PDB-style file with coordinates for d3g6wc_.
(The format of our PDB-style files is described here.)

Timeline for d3g6wc_: