Lineage for d3g62a_ (3g62 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009379Species Pseudomonas fluorescens [TaxId:294] [189065] (2 PDB entries)
  8. 1009380Domain d3g62a_: 3g62 A: [176384]
    automated match to d2v3qa1
    complexed with edo, po4, so4

Details for d3g62a_

PDB Entry: 3g62 (more details), 0.98 Å

PDB Description: Subatomic resolution structure of PfluDING at pH 4.5
PDB Compounds: (A:) PfluDING

SCOPe Domain Sequences for d3g62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g62a_ c.94.1.1 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
mdingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwa
gsdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavnlsvqelcgvfsg
rintwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsgg
lpagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgv
spaaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsq
cyadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsign
tnvcngigrplleaa

SCOPe Domain Coordinates for d3g62a_:

Click to download the PDB-style file with coordinates for d3g62a_.
(The format of our PDB-style files is described here.)

Timeline for d3g62a_:

  • d3g62a_ is new in SCOPe 2.01-stable
  • d3g62a_ does not appear in SCOPe 2.02