Lineage for d3g5mb_ (3g5m B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856520Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2856618Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2856619Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)
  8. 2856656Domain d3g5mb_: 3g5m B: [176383]
    automated match to d1qr2a_
    complexed with fad, xm5, zn

Details for d3g5mb_

PDB Entry: 3g5m (more details), 1.84 Å

PDB Description: Synthesis of Casimiroin and Optimization of Its Quinone Reductase 2 and Aromatase Inhibitory activity
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d3g5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g5mb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d3g5mb_:

Click to download the PDB-style file with coordinates for d3g5mb_.
(The format of our PDB-style files is described here.)

Timeline for d3g5mb_: