![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
![]() | Protein automated matches [190539] (7 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189208] (2 PDB entries) |
![]() | Domain d3g5ic_: 3g5i C: [176380] Other proteins in same PDB: d3g5ib2, d3g5id2 automated match to d3b9xc1 complexed with bme, ca, dnb |
PDB Entry: 3g5i (more details), 2.1 Å
SCOPe Domain Sequences for d3g5ic_:
Sequence, based on SEQRES records: (download)
>d3g5ic_ c.70.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi pvaggavkplmreliiadnvhgesgldgpalpeptfapqnctavelmaktlresaepvti vstgpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsg ipvvmagldvthkaqihvedterfraignpvstivaelldffleyhkdekwgfvgaplhd pctiawllkpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvd lladrlkfya
>d3g5ic_ c.70.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi pvaggavkplmrelgldgpalpeptfapqnctavelmaktlresaepvtivstgpqtnva lllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsgipvvmagldv thkaqihvedterfraignpvstivaelldfekwgfvgaplhdpctiawllkpelftsve rwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvdlladrlkfya
Timeline for d3g5ic_: