Lineage for d3gstb1 (3gst B:85-217)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3903Species Rat (Rattus norvegicus), class mu [TaxId:10116] [47623] (14 PDB entries)
  8. 3913Domain d3gstb1: 3gst B:85-217 [17638]
    Other proteins in same PDB: d3gsta2, d3gstb2

Details for d3gstb1

PDB Entry: 3gst (more details), 1.9 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d3gstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gstb1 a.45.1.1 (B:85-217) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d3gstb1:

Click to download the PDB-style file with coordinates for d3gstb1.
(The format of our PDB-style files is described here.)

Timeline for d3gstb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gstb2