Lineage for d3g5ib1 (3g5i B:2-311)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136800Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2136801Protein automated matches [190539] (5 species)
    not a true protein
  7. 2136805Species Escherichia coli K-12 [TaxId:83333] [189208] (2 PDB entries)
  8. 2136807Domain d3g5ib1: 3g5i B:2-311 [176379]
    Other proteins in same PDB: d3g5ib2, d3g5id2
    automated match to d3b9xc1
    complexed with bme, ca, dnb

Details for d3g5ib1

PDB Entry: 3g5i (more details), 2.1 Å

PDB Description: Crystal Structure of the E.coli RihA pyrimidine nucleosidase bound to a iminoribitol-based inhibitor
PDB Compounds: (B:) Pyrimidine-specific ribonucleoside hydrolase rihA

SCOPe Domain Sequences for d3g5ib1:

Sequence, based on SEQRES records: (download)

>d3g5ib1 c.70.1.0 (B:2-311) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi
pvaggavkplmreliiadnvhgesgldgpalpeptfapqnctavelmaktlresaepvti
vstgpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsg
ipvvmagldvthkaqihvedterfraignpvstivaelldffleyhkdekwgfvgaplhd
pctiawllkpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvd
lladrlkfya

Sequence, based on observed residues (ATOM records): (download)

>d3g5ib1 c.70.1.0 (B:2-311) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrtdi
pvaggavkplmrelgldgpalpeptfapqnctavelmaktlresaepvtivstgpqtnva
lllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsgipvvmagldv
thkaqihvedterfraignpvstivaelldfflkwgfvgaplhdpctiawllkpelftsv
erwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvdlladrlkfya

SCOPe Domain Coordinates for d3g5ib1:

Click to download the PDB-style file with coordinates for d3g5ib1.
(The format of our PDB-style files is described here.)

Timeline for d3g5ib1: