Lineage for d3gsta1 (3gst A:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713121Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 2713138Domain d3gsta1: 3gst A:85-217 [17637]
    Other proteins in same PDB: d3gsta2, d3gstb2
    complexed with gpr, so4

Details for d3gsta1

PDB Entry: 3gst (more details), 1.9 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3gsta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsta1 a.45.1.1 (A:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOPe Domain Coordinates for d3gsta1:

Click to download the PDB-style file with coordinates for d3gsta1.
(The format of our PDB-style files is described here.)

Timeline for d3gsta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gsta2