SCOPe 2.06: Domain d3g4za_: 3g4z A:

Lineage for d3g4za_ (3g4z A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family)
   automatically mapped to Pfam PF09055

5. Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)

6. Protein automated matches [191040] (1 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [188872] (4 PDB entries)

8. Domain d3g4za_: 3g4z A: [176365]
   automated match to d1t6ua_
   complexed with br, ni; mutant

Details for d3g4za_

PDB Entry: 3g4z, 1.87 Å

PDB Description: crystal structure of nisod y9f mutant at 1.9 a

PDB Compounds: (A:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d3g4za_:

Sequence; same for both SEQRES and ATOM records:

>d3g4za_ a.24.22.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka

Timeline for d3g4za_:

• d3g4za_ first appeared in SCOPe 2.01
  
• d3g4za_ appears in SCOPe 2.05
  
• d3g4za_ appears in SCOPe 2.07
  
• d3g4za_ appears in the current release, SCOPe 2.08