| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin I [46464] (2 species) |
| Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) |
| Domain d3g4yb_: 3g4y B: [176364] automated match to d1nxfa_ complexed with 9cl, cmo, hem |
PDB Entry: 3g4y (more details), 1.7 Å
SCOPe Domain Sequences for d3g4yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4yb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal
Timeline for d3g4yb_: