Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) |
Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
Protein automated matches [191040] (1 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [188872] (3 PDB entries) |
Domain d3g4xa_: 3g4x A: [176360] automated match to d1t6ua_ complexed with cl, ni; mutant |
PDB Entry: 3g4x (more details), 2.01 Å
SCOPe Domain Sequences for d3g4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4xa_ a.24.22.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]} hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
Timeline for d3g4xa_: