Lineage for d3g4xa_ (3g4x A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 910577Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 910578Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. 910654Protein automated matches [191040] (1 species)
    not a true protein
  7. 910655Species Streptomyces coelicolor [TaxId:1902] [188872] (3 PDB entries)
  8. 910662Domain d3g4xa_: 3g4x A: [176360]
    automated match to d1t6ua_
    complexed with cl, ni; mutant

Details for d3g4xa_

PDB Entry: 3g4x (more details), 2.01 Å

PDB Description: crystal structure of nisod y9f mutant
PDB Compounds: (A:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d3g4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g4xa_ a.24.22.1 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka

SCOPe Domain Coordinates for d3g4xa_:

Click to download the PDB-style file with coordinates for d3g4xa_.
(The format of our PDB-style files is described here.)

Timeline for d3g4xa_: