SCOPe 2.01: Domain d3g4wb_: 3g4w B:

Lineage for d3g4wb_ (3g4w B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)

8. Domain d3g4wb_: 3g4w B: [176359]
   automated match to d1nxfa_
   complexed with 8cl, cmo, hem

Details for d3g4wb_

PDB Entry: 3g4w, 1.9 Å

PDB Description: Ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chlorobenzene bound to the XE4 cavity

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3g4wb_:

Sequence; same for both SEQRES and ATOM records:

>d3g4wb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3g4wb_:

• d3g4wb_ is new in SCOPe 2.01-stable
  
• d3g4wb_ appears in SCOPe 2.02
  
• d3g4wb_ appears in the current release, SCOPe 2.08