Lineage for d3g4vb_ (3g4v B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299610Protein Hemoglobin I [46464] (2 species)
  7. 2299611Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2299695Domain d3g4vb_: 3g4v B: [176357]
    automated match to d1nxfa_
    complexed with 7cl, cmo, hem

Details for d3g4vb_

PDB Entry: 3g4v (more details), 2.1 Å

PDB Description: ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloropentane bound to the xe4 cavity
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3g4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g4vb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3g4vb_:

Click to download the PDB-style file with coordinates for d3g4vb_.
(The format of our PDB-style files is described here.)

Timeline for d3g4vb_: