Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin I [46464] (2 species) |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries) |
Domain d3g4ub_: 3g4u B: [176355] automated match to d1nxfa_ complexed with 0cl, cmo, hem |
PDB Entry: 3g4u (more details), 2.1 Å
SCOPe Domain Sequences for d3g4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4ub_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv lasknfgdkyanawaklvavvqaal
Timeline for d3g4ub_: