Lineage for d3g4ub_ (3g4u B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686141Protein Hemoglobin I [46464] (2 species)
  7. 2686142Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2686222Domain d3g4ub_: 3g4u B: [176355]
    automated match to d1nxfa_
    complexed with 0cl, cmo, hem

Details for d3g4ub_

PDB Entry: 3g4u (more details), 2.1 Å

PDB Description: ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and dichloropropane bound to the xe4 cavity
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3g4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g4ub_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3g4ub_:

Click to download the PDB-style file with coordinates for d3g4ub_.
(The format of our PDB-style files is described here.)

Timeline for d3g4ub_: