Lineage for d3g4ua_ (3g4u A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 901969Protein Hemoglobin I [46464] (2 species)
  7. 901970Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)
  8. 902035Domain d3g4ua_: 3g4u A: [176354]
    automated match to d1nxfa_
    complexed with 0cl, cmo, hem

Details for d3g4ua_

PDB Entry: 3g4u (more details), 2.1 Å

PDB Description: ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and dichloropropane bound to the xe4 cavity
PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3g4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g4ua_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3g4ua_:

Click to download the PDB-style file with coordinates for d3g4ua_.
(The format of our PDB-style files is described here.)

Timeline for d3g4ua_: