SCOPe 2.01: Domain d3g4qa_: 3g4q A:

Lineage for d3g4qa_ (3g4q A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)

8. Domain d3g4qa_: 3g4q A: [176350]
   automated match to d1nxfa_
   complexed with cmo, hem, mch

Details for d3g4qa_

PDB Entry: 3g4q, 1.6 Å

PDB Description: Ligand migration and cavities within scapharca dimeric hemoglobin: wild type with co bound to heme and chloroform bound to the XE4 cavity

PDB Compounds: (A:) Globin-1

SCOPe Domain Sequences for d3g4qa_:

Sequence; same for both SEQRES and ATOM records:

>d3g4qa_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3g4qa_:

• d3g4qa_ is new in SCOPe 2.01-stable
  
• d3g4qa_ appears in SCOPe 2.02
  
• d3g4qa_ appears in the current release, SCOPe 2.08