Lineage for d3g4ad_ (3g4a D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944317Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1944318Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1944319Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1944398Protein automated matches [191028] (2 species)
    not a true protein
  7. 1944404Species Thermotoga maritima [TaxId:243274] [188837] (1 PDB entry)
  8. 1944408Domain d3g4ad_: 3g4a D: [176345]
    automated match to d1kq4b_
    complexed with fad, ump; mutant

Details for d3g4ad_

PDB Entry: 3g4a (more details), 1.95 Å

PDB Description: crystal structure of flavine dependant thymidylate synthase s88a mutant from thermotoga maritima at 1.95 angstrom resolution
PDB Compounds: (D:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3g4ad_:

Sequence, based on SEQRES records: (download)

>d3g4ad_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelagrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkev

Sequence, based on observed residues (ATOM records): (download)

>d3g4ad_ d.207.1.1 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfeerdrhlieylmkhghetpfehivftfhv
kapifvarqwfrhriasynelagrysklsyefyipsperlegykttippervtekiseiv
dkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaqweiqqy
alaiarifkekcpwtfeaflkyaykgdilkev

SCOPe Domain Coordinates for d3g4ad_:

Click to download the PDB-style file with coordinates for d3g4ad_.
(The format of our PDB-style files is described here.)

Timeline for d3g4ad_: