Lineage for d3g49c_ (3g49 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2449763Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2449764Species Guinea pig (Cavia porcellus) [TaxId:10141] [117425] (4 PDB entries)
    Uniprot Q6QLL4 23-296
  8. 2449777Domain d3g49c_: 3g49 C: [176340]
    automated match to d1xsea_
    complexed with 3g4, nap

Details for d3g49c_

PDB Entry: 3g49 (more details), 2.5 Å

PDB Description: n-(pyridin-2-yl) arylsulfonamide inhibitors of 11b-hydroxysteroid dehydrogenase type 1: discovery of pf-915275
PDB Compounds: (C:) 11-beta-hydroxysteroid dehydrogenase 1

SCOPe Domain Sequences for d3g49c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g49c_ c.2.1.2 (C:) 11-beta-hydroxysteroid dehydrogenase 1 {Guinea pig (Cavia porcellus) [TaxId: 10141]}
kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
yllgnpgrkimeflsaaeynwdn

SCOPe Domain Coordinates for d3g49c_:

Click to download the PDB-style file with coordinates for d3g49c_.
(The format of our PDB-style files is described here.)

Timeline for d3g49c_: